Buy Cagrilintide for Research: 2 Vendors Compared (Prices, COAs)
Checked, not rated · Updated 3 October 2026
Cagrilintide is not approved by FDA for human use, and it is sold in the US labelled for research use only. 2 of the 3 vendors I check sell it online (Next Level Pharm and BioEdge Research Labs), from $59 for a 5 mg vial as of 3 October 2026.
The table compares vendors on FDA record, testing lab, batch COAs and price. Before buying from anyone, run my vendor checklist.
- Class
- Long-acting amylin receptor agonist
- Background
- Investigational amylin analogue studied alone and, more prominently, combined with semaglutide as the fixed-dose combination CagriSema, for chronic weight management.
- Human evidence
- Moderate human evidence
The evidence, risks and legal detail: my Cagrilintide guide. Dosing and vial maths: Cagrilintide dosage.
Cagrilintide vendors compared
The checklist results come from my review of each vendor and cover the whole store. A vendor can publish COAs for some products and not others. The featured vendor is pinned first; the order is not a ranking.
| Vendor | Product | Price | FDA record | Names its lab | Batch COAs | Card payment | Link |
|---|---|---|---|---|---|---|---|
| Next Level PharmFeaturedMy Next Level Pharm review | 5 mg vial | $64.99as of 3 October 2026 | No warning letter found | Yes | Yes | Yes | View product → |
| BioEdge Research LabsMy BioEdge Research Labs review | 5 mg vial | $59.00as of 3 October 2026 | No warning letter found | Yes | Yes | Not verified | View product → |
Prices are for the product named, as shown on the vendor's own product page on the date given. They change often. Checklist results were verified on 3 October 2026. All vendors and how they compare.
What a Cagrilintide COA should show
A certificate of analysis (COA) is the lab report for one batch. For cagrilintide, check these:
- Identity by mass spectrometry, with the expected and the measured mass side by side. For cagrilintide, expect about 4,409.1 Da (C194H312N54O59S2); the sequence is 37 amino acids, KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP.
- Cagrilintide carries a fatty-acid chain and one disulfide bond. A vial that blends it with semaglutide needs a COA that reports each peptide separately.
- Purity by HPLC for this batch, shown as a chromatogram as well as a percentage.
- A lot number that matches your vial or pack, the test date and the lab's name, so you can confirm the certificate on the lab's own site.
A purity figure does not cover sterility or bacterial endotoxins; a COA covers those only if it reports separate tests for them. Line by line: how to read a peptide COA.
Red flags when buying cagrilintide
- A product sold as CagriSema. Novo Nordisk's combination is not approved in the US.
- No certificate of analysis for the batch you will receive, or one without a lot number or a named lab.
- Dosing instructions or treatment claims for people on the product page.
- An FDA warning letter naming the seller. Search fda.gov before you pay.
- No way to pay with buyer protection, such as a credit card.
Common questions
Where can I buy cagrilintide?
Online, from research vendors that label it for laboratory use only. I list 2 checked vendors: Next Level Pharm and BioEdge Research Labs, from $59 for a 5 mg vial as of 3 October 2026. Before you pay, confirm the batch COA on the testing lab's own site.
Is cagrilintide for sale legally?
Cagrilintide is sold in the US labelled for laboratory research use only. It is not approved by FDA for human use, and it cannot lawfully be marketed as a supplement or a medicine. Novo Nordisk filed a New Drug Application for CagriSema (cagrilintide with semaglutide) in December 2025; by the company's account, FDA review is ongoing. This is general information, not legal advice.
Do I need a prescription for cagrilintide?
No US-approved cagrilintide product exists for a doctor to prescribe. Research vendors sell it without a prescription, labelled for laboratory use only. FDA says cagrilintide cannot be used in compounding under federal law.
How much does cagrilintide cost?
On the vendors' own product pages: Next Level Pharm, 5 mg vial, $64.99 (as of 3 October 2026); BioEdge Research Labs, 5 mg vial, $59.00 (as of 3 October 2026). Prices change often, so check the product page before you rely on one.
How do I know if cagrilintide is real?
Only a lab test can tell you. Ask for the certificate of analysis (COA) for your batch, and confirm it on the testing lab's own site. The mass spectrometry result should match the expected mass of cagrilintide, about 4,409.1 daltons (C194H312N54O59S2). A vendor's COAs for other products say nothing about this one, so check that the certificate names cagrilintide and your lot number.
Who sells the best cagrilintide?
I don't rank vendors, so I don't name a best one. Compare what each lets you check: a named testing lab, a COA for your lot that the lab confirms on its own site, and no FDA warning letter. The table shows my checklist result for each vendor. A vendor that passes every check can still ship a bad batch.
Sources
- Vendor checks: my review of each vendor, on the date shown under the table. Products and prices: each vendor's own product page.
- Legal status, class and evidence: my Cagrilintide guide, which cites its sources. Formula, mass and sequence: the structure record shown on that guide, checked against two sources.
- FDA's concerns with unapproved GLP-1 drugs used for weight loss (page updated 1 October 2026), US Food and Drug Administration.